PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031758
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 325aa    MW: 36273.5 Da    PI: 4.2071
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031758genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.48.1e-094361648
                     HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     ++++G ++W++ ++  g+ R++k+c++rw +yl
      Lus10031758  4 IQKYGHENWRALPKQAGLLRCGKSCRLRWINYL 36
                     79***************99************97 PP

2Myb_DNA-binding47.93.1e-154287148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T eE+  +++++ ++G++ W++Ia++++ gRt++++k+ w+++l
      Lus10031758 42 RGNFTFEEENTIIRLHLEFGNK-WSKIASRLP-GRTDNEIKNVWNTHL 87
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.617136IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-15243IPR009057Homeodomain-like
SMARTSM0071720238IPR001005SANT/Myb domain
SuperFamilySSF466895.08E-22383IPR009057Homeodomain-like
PfamPF002492.9E-7336IPR001005SANT/Myb domain
CDDcd001670.00129436No hitNo description
PROSITE profilePS5129423.4553791IPR017930Myb domain
SMARTSM007172.6E-144189IPR001005SANT/Myb domain
PfamPF002492.1E-144287IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-264491IPR009057Homeodomain-like
CDDcd001671.44E-94487No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSFIQKYGHE NWRALPKQAG LLRCGKSCRL RWINYLRPDV KRGNFTFEEE NTIIRLHLEF  60
GNKWSKIASR LPGRTDNEIK NVWNTHLKKR LSSSSLINDD LTNQSSSPTS SSSSSSLSST  120
TTSSGKKRNS TETTETEKQR TKKQKITTLL NQEESDEDQD QDEEGEIEDG FINIDELKSF  180
EEESKGISSS SVSSVLIPSS GQIDNVVTVE DQIDSLFELG ESAGNVFDDL DFRISSEPEE  240
DMEFWSLLDG IIGEASTDQQ PTGEVVGFGD SDIDMGVQSA EDAENDNQKW LRYLETELGL  300
EEINNGGSDK KNQEDCKVQG IEGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-2019116105C-Myb DNA-Binding Domain
1msf_C2e-2019116105C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.12e-57myb domain protein 58